Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA032138 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA032138, RRID:AB_10669675
- Product name
- Anti-PRTG
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HYIIDDLEPASNYTFYIVAYMPMGASQMSDHVTQN
TLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRR
GQVVLYRLSFR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Early rhombic lip Protogenin+ve stem cells in a human-specific neurovascular niche initiate and maintain group 3 medulloblastoma
Visvanathan A, Saulnier O, Chen C, Haldipur P, Orisme W, Delaidelli A, Shin S, Millman J, Bryant A, Abeysundara N, Wu X, Hendrikse L, Patil V, Bashardanesh Z, Golser J, Livingston B, Nakashima T, Funakoshi Y, Ong W, Rasnitsyn A, Aldinger K, Richman C, Van Ommeren R, Lee J, Ly M, Vladoiu M, Kharas K, Balin P, Erickson A, Fong V, Zhang J, Suárez R, Wang H, Huang N, Pallota J, Douglas T, Haapasalo J, Razavi F, Silvestri E, Sirbu O, Worme S, Kameda-Smith M, Wu X, Daniels C, MichaelRaj A, Bhaduri A, Schramek D, Suzuki H, Garzia L, Ahmed N, Kleinman C, Stein L, Dirks P, Dunham C, Jabado N, Rich J, Li W, Sorensen P, Wechsler-Reya R, Weiss W, Millen K, Ellison D, Dimitrov D, Taylor M
Cell 2024;187(17):4733-4750.e26
Cell 2024;187(17):4733-4750.e26
No comments: Submit comment
No validations: Submit validation data