PAB23664

TMEM98 antibody from Abnova Corporation
DKFZP564K1964
Western blot
Data presented on provider website
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
PAB23664
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23664, RRID:AB_11120931
Product name
TMEM98 polyclonal antibody
Provider product page
Abnova Corporation - PAB23664
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human TMEM98.
Description
Rabbit polyclonal antibody raised against recombinant TMEM98.
Reactivity
Human
Host
Rabbit
Antigen sequence
CRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSE
LELDDVVITNPHIEAILENEDWIEDASGLMSHCIA
ILKICHTLTEKLVAMTMGSGAKMKTSASVS
Isotype
IgG
Vial size
100 μL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.