HPA024704

GFRA2 antibody from Atlas Antibodies
GDNFRB, NTNRA, RETL2, TRNR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024704
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024704, RRID:AB_1849629
Product name
Anti-GFRA2
Provider product page
Atlas Antibodies - HPA024704
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSR
YRTLRQCLAGRDRNTMLANKECQAALEVLQESPLY
DCR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -