ABIN487261

GFRA2 antibody from antibodies-online
GDNFRB, NTNRA, RETL2, TRNR2

Antibody data

Product number
ABIN487261
Provider
antibodies-online
Product name
anti-GDNF Family Receptor alpha 2 (GFRA2) (C-Term) antibody
Provider product page
antibodies-online - ABIN487261
Antibody type
Polyclonal
Antigen
The immunogen for anti-GFRA2 antibody: synthetic peptide directed towards the C terminal of human GFRA2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGT
SVITT CTSVQEQGLK
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -