Antibody data

Product number
HPA044356
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044356, RRID:AB_10959902
Product name
Anti-UAP1L1
Provider product page
Atlas Antibodies - HPA044356
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLP
CRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFE
QRLLPAVTFDGKVILER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.