Antibody data

Product number
PAB24321
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24321, RRID:AB_11121241
Product name
UAP1L1 polyclonal antibody
Provider product page
Abnova Corporation - PAB24321
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant UAP1L1.
Antigen sequence
SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLP
CRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFE
QRLLPAVTFDGKVILER
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.