HPA003353

SLC16A2 antibody from Sigma-Aldrich
AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003353
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003353, RRID:AB_1079343
Product name
Anti-SLC16A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003353
Antibody type
Polyclonal
Antigen
Monocarboxylate transporter 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSRNKYQPQSGSSGPSSHSPPAAMALQSQASEEAK
GPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVP
PPEPQPEPQPLPDPAPLPELEFESERVHEPEPT
Storage
-20C
Provider Type Product Number
- No reagents -