Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00158880-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00158880-A01, RRID:AB_463546
- Product name
- USP51 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant USP51.
- Antigen sequence
KHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDK
DIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFE
DKQSTCE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- USP51 polyclonal antibody (A01), Lot # 051205JCO1 Western Blot analysis of USP51 expression in Hela S3 NE ( Cat # L013V3 ).
- Validation comment
- Western Blot (Cell lysate)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- USP51 polyclonal antibody (A01). Western Blot analysis of USP51 expression in PC-12.