Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28328 - Provider product page
- Provider
- Abnova Corporation
- Product name
- RESP18 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant RESP18.
- Antigen sequence
PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPV
KITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWAT
S- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow with RESP18 polyclonal antibody ( Cat # PAB28328 ) shows strong nuclear and cytoplasmic positivity in hematopoietic cells at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)