HPA003319

ZNF157 antibody from Sigma-Aldrich
HZF22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003319
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003319, RRID:AB_1080677
Product name
Anti-ZNF157 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003319
Antibody type
Polyclonal
Antigen
Zinc finger protein 157 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSNLASVGLCVAKPEMIFKLERGEELWILEEESSG
HGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQT
LDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFEC
HECGKAYCRKSNLVEHLRIHTGER
Storage
-20C
Provider Type Product Number
- No reagents -