H00008568-B01P

RRP1 antibody from Abnova Corporation
D21S2056E, NNP-1, Nop52, RRP1A

Antibody data

Product number
H00008568-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008568-B01P, RRID:AB_10902830
Product name
RRP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008568-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RRP1 protein.
Antigen sequence
MVSRVQLPPEIQLAQRLAGNEQVTRDRAVRKLRKY
IVARTQRAAGGFTHDELLKVWKGLFYCMWMQDKPL
LQEELGRTISQLVHAFQTTEAQHLFLQAFWQTMNR
EWTGIDRLRLDKFYMLMRMVLNESLKVLKMQGWEE
RQIEELLELLMTEILHPSSQAPNGVKSHFIEIFLE
ELTKVGAEELTADQNLKFIDPFCRIAARTKDSLVL
NNITRGIFETIVEQAPLAIEDLLNELDTQDEEVAS
DSDESSEGGERGDALSQKRSEKPPAGSICRAEPEA
GEEQAGDDRDSGGPVLQFDYEAVANRLFEMASRQS
TPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACR
RLLEGRRQKKTKKQKRLLRLQQERGKGEKEPPSPG
MERKRSRRRGVGADPEARAEAGEQPGTAERALLRD
QPRGRGQRGARQRRRTPRPLTSARAKAANVQEPEK
KKKRRE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -