HPA016818

RRP1 antibody from Sigma-Aldrich
D21S2056E, NNP-1, Nop52, RRP1A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016818
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016818, RRID:AB_1854561
Product name
Anti-RRP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016818
Antibody type
Polyclonal
Antigen
Ribosomal RNA processing protein 1 homolog A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVAN
RLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFP
EDEIPEKACRRLLEGRRQKK
Storage
-20C
Provider Type Product Number
- No reagents -