HPA016818

RRP1 antibody from Atlas Antibodies
D21S2056E, NNP-1, Nop52, RRP1A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016818, RRID:AB_1854561
Product name
Anti-RRP1
Provider product page
Atlas Antibodies - HPA016818
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVAN
RLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFP
EDEIPEKACRRLLEGRRQKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -