HPA013788

C1orf210 antibody from Atlas Antibodies
MGC52423
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013788
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013788, RRID:AB_1233610
Product name
Anti-C1orf210
Provider product page
Atlas Antibodies - HPA013788
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDN
YIQPGTGELGTEGSRDHF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -