Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310523 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC39A6 antibody: synthetic peptide directed towards the middle region of human SLC39A6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISII
SFLSL LGVILVPLMN- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Exosomal secretion of death bullets: a new way of apoptotic escape?
Trokovic N, Pöllänen R, Porola P, Stegaev V, Hetzel U, Tivesten Å, Engdahl C, Carlsten H, Forsblad-d'Elia H, Fagman JB, Lagerquist M, Konttinen YT
American journal of physiology. Endocrinology and metabolism 2012 Oct 15;303(8):E1015-24
American journal of physiology. Endocrinology and metabolism 2012 Oct 15;303(8):E1015-24
No comments: Submit comment
No validations: Submit validation data