HPA003130

EBP antibody from Sigma-Aldrich
CDPX2, CHO2, CPX, CPXD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003130
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003130, RRID:AB_1078717
Product name
Anti-EBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003130
Antibody type
Polyclonal
Antigen
3-beta-Hydroxysteroid-Delta8,Delta7-isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
Storage
-20C
Provider Type Product Number
- No reagents -