Antibody data

Product number
PAB21298
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21298, RRID:AB_10964832
Product name
LOC51233 polyclonal antibody
Provider product page
Abnova Corporation - PAB21298
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human LOC51233.
Reactivity
Human
Host
Rabbit
Antigen sequence
ILPSRVQGGCYRFDSSSCSSEDNLSLVCLPRSEDD
DCDDDDDDAQILPSRVQACSEDSLFLRCSLRHKDE
EEEDDDD
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -