HPA020446

DRICH1 antibody from Sigma-Aldrich
C22orf43
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020446
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020446, RRID:AB_1853151
Product name
Anti-AP000346.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020446
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein LOC51233 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILPSRVQGGCYRFDSSSCSSEDNLSLVCLPRSEDD
DCDDDDDDAQILPSRVQACSEDSLFLRCSLRHKDE
EEEDDDD
Storage
-20C
Provider Type Product Number
- No reagents -