HPA042548

CACTIN antibody from Atlas Antibodies
C19orf29, fSAPc, NY-REN-24

Antibody data

Product number
HPA042548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042548, RRID:AB_10794760
Product name
Anti-CACTIN
Provider product page
Atlas Antibodies - HPA042548
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQR
LQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEA
QFSVEMPLTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.