PAB23952

CACTIN antibody from Abnova Corporation
C19orf29, fSAPc, NY-REN-24

Antibody data

Product number
PAB23952
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23952, RRID:AB_11121374
Product name
C19orf29 polyclonal antibody
Provider product page
Abnova Corporation - PAB23952
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C19orf29.
Antigen sequence
SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQR
LQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEA
QFSVEMPLTG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.