Antibody data

Product number
H00056000-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056000-M06, RRID:AB_1237805
Product name
NXF3 monoclonal antibody (M06), clone 3A9
Provider product page
Abnova Corporation - H00056000-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NXF3.
Antigen sequence
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSE
PVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYT
ISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNM
PDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVP
FVPVEFHYENMHASFFVENASIAYALKNVSGKIWD
EDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAM
NQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRK
CMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCA
DRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSP
RATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ
QYYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDS
APSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNG
VFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVND
KLFVRDTSHQGTQSALFTLVPTAFSSSMPAFSQEQ
QKMLPS
Isotype
IgG
Antibody clone number
3A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -