Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184044 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear RNA Export Factor 3 (NXF3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NXF3 antibody: synthetic peptide directed towards the C terminal of human NXF3
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVL
AFTRT FIATPGSSSS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NXF5, a novel member of the nuclear RNA export factor family, is lost in a male patient with a syndromic form of mental retardation.
Jun L, Frints S, Duhamel H, Herold A, Abad-Rodrigues J, Dotti C, Izaurralde E, Marynen P, Froyen G
Current biology : CB 2001 Sep 18;11(18):1381-91
Current biology : CB 2001 Sep 18;11(18):1381-91
No comments: Submit comment
No validations: Submit validation data