Antibody data

Product number
PAB23864
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23864, RRID:AB_11121984
Product name
C3orf70 polyclonal antibody
Provider product page
Abnova Corporation - PAB23864
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C3orf70.
Antigen sequence
ARRPDFQPCDGLSICATHSHGKCFKLHWCCHLGWC
HCKYMYQPMTPVEQLPSTEIPARPREPTNTIQISV
SLTEHFLKFASVFQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.