HPA059294

DTX4 antibody from Atlas Antibodies
KIAA0937, RNF155
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA059294
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059294, RRID:AB_2683969
Product name
Anti-DTX4
Provider product page
Atlas Antibodies - HPA059294
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPA
SPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIA
SGVPTVPVKNLNGSSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -