Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108648 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PHYHIP antibody: synthetic peptide directed towards the N terminal of human PHYHIP
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYS
VAVQTAVKQSDGEYL- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Dual-specificity tyrosine-phosphorylated and regulated kinase 1A (DYRK1A) interacts with the phytanoyl-CoA alpha-hydroxylase associated protein 1 (PAHX-AP1), a brain specific protein.
Bescond M, Rahmani Z
The international journal of biochemistry & cell biology 2005 Apr;37(4):775-83
The international journal of biochemistry & cell biology 2005 Apr;37(4):775-83
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Transfected 293T; WB Suggested Anti-PHYHIP Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T; PHYHIP antibody - N-terminal region (AP42242PU-N) in Transfected 293T cells using Western Blot