Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309717 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PHYHIP antibody: synthetic peptide directed towards the N terminal of human PHYHIP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYS
VAVQT AVKQSDGEYL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Dual-specificity tyrosine-phosphorylated and regulated kinase 1A (DYRK1A) interacts with the phytanoyl-CoA alpha-hydroxylase associated protein 1 (PAHX-AP1), a brain specific protein.
Bescond M, Rahmani Z
The international journal of biochemistry & cell biology 2005 Apr;37(4):775-83
The international journal of biochemistry & cell biology 2005 Apr;37(4):775-83
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting