Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA067602 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA067602, RRID:AB_2685871
- Product name
- Anti-HAS1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQP
WEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRR
CVCV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Comprehensive histological investigation of age-related changes in dermal extracellular matrix and muscle fibers in the upper lip vermilion.
Gomi T, Imamura T
International journal of cosmetic science 2020 Aug;42(4):359-368
International journal of cosmetic science 2020 Aug;42(4):359-368
No comments: Submit comment
No validations: Submit validation data