HPA023769

BIN3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023769
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023769, RRID:AB_1845361
Product name
Anti-BIN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023769
Antibody type
Polyclonal
Antigen
Bridging integrator 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDA
DLAMSKSAVKISLDLLSNPLCEQDQD
Storage
-20C
Provider Type Product Number
- No reagents -