HPA003139

AFF2 antibody from Sigma-Aldrich
FMR2, FRAXE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003139
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003139, RRID:AB_1078107
Product name
Anti-AFF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003139
Antibody type
Polyclonal
Antigen
AF4/FMR2 family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEI
CGASLTLSTLMSSSGSNNNLSISNEEPTFSPIPVM
QTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSL
HAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRK
H
Storage
-20C
Provider Type Product Number
- No reagents -