HPA001299

METTL3 antibody from Sigma-Aldrich
M6A, MT-A70, Spo8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001299
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001299, RRID:AB_1079419
Product name
Anti-METTL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001299
Antibody type
Polyclonal
Antigen
Adenosine-N6 methyltransferase 70 kDa subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKA
SDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFH
MDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQ
SVGGDSSADRLFPPQWICCDIRYLDVSILGKFA
Storage
-20C
Provider Type Product Number
- No reagents -