AMAb90624
antibody from Atlas Antibodies
Targeting: TSPAN7
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90624 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90624, RRID:AB_2665609
- Product name
- Anti-TSPAN7
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV
QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHN
LTVAATKVNQKGCYDLVTSFMET- Epitope
- Binds to an epitope located within the peptide sequence TDCNPQDLHNLTVAA as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0265
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong immunoreactivity in the endocrine pancreatic islets cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- immunohistochemical staining of human cerebellum shows moderate positivity in the molecular layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate immunoreactivity in renal glomerulus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows absence of immunoreactivity (negative control).