H00007102-A01

TSPAN7 antibody from Abnova Corporation
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
No application information provided.

Antibody data

Product number
H00007102-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007102-A01, RRID:AB_607245
Product name
TSPAN7 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00007102-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant TSPAN7.
Antigen sequence
RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRS
LSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCN
PQDLHNLTVAATKVNQKGCYDLVTSFMETN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -