HPA003140

TSPAN7 antibody from Atlas Antibodies
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003140
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003140, RRID:AB_1078454
Product name
Anti-TSPAN7
Provider product page
Atlas Antibodies - HPA003140
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV
QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHN
LTVAATKVNQKGCYDLVTSFMET
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -