AMAb90621

TSPAN7 antibody from Atlas Antibodies
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
AMAb90621
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb90621, RRID:AB_2665608
Product name
Anti-TSPAN7
Provider product page
Atlas Antibodies - AMAb90621
Antibody type
Monoclonal
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV
QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHN
LTVAATKVNQKGCYDLVTSFMET
Epitope
Binds to an epitope located within the peptide sequence NDERSRAVDHVQRSL as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL0262
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -