AMAb90621
antibody from Atlas Antibodies
Targeting: TSPAN7
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90621 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90621, RRID:AB_2665608
- Product name
- Anti-TSPAN7
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV
QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHN
LTVAATKVNQKGCYDLVTSFMET- Epitope
- Binds to an epitope located within the peptide sequence NDERSRAVDHVQRSL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0262
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401460)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the neuropil.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong positivity in the molecular layer and moderate staining in the granular cell layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong positivity in the islets of Langerhans.