HPA003140

TSPAN7 antibody from Sigma-Aldrich
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003140, RRID:AB_1078454
Product name
Anti-TSPAN7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003140
Antibody type
Polyclonal
Antigen
Tetraspanin-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGV
QNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHN
LTVAATKVNQKGCYDLVTSFMET
Storage
-20C
Provider Type Product Number
- No reagents -