SAB1401387

TSPAN7 antibody from Sigma-Aldrich
A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2
No application information provided.

Antibody data

Product number
SAB1401387
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401387, RRID:AB_10609330
Product name
Anti-TSPAN7 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401387
Antibody type
Polyclonal
Antigen
TSPAN7 (NP_004606.2, 1 a.a. ~ 249 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLA
VGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIV
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVA
GISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRA
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCC
MNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ
YEMV
Storage
-20C
Provider Type Product Number
- No reagents -