Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA025064 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA025064, RRID:AB_1855174
- Product name
- Anti-PEBP4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEAS
TQFMTQNYQDSPTLQAPRERASEPKHK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas
Kim I, Quigley D, To M, Pham P, Lin K, Jo B, Jen K, Raz D, Kim J, Mao J, Jablons D, Balmain A
Nature Communications 2013 April;4
Nature Communications 2013 April;4
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in tubular cells.
- Sample type
- HUMAN