HPA025064

PEBP4 antibody from Sigma-Aldrich
CORK1, hPEBP4, MGC22776
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025064
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025064, RRID:AB_1855174
Product name
Anti-AC105046.10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025064
Antibody type
Polyclonal
Antigen
Phosphatidylethanolamine-binding protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEAS
TQFMTQNYQDSPTLQAPRERASEPKHK
Storage
-20C
Provider Type Product Number
- No reagents -