HPA048979

antibody from Atlas Antibodies

Targeting: CYP21A2 CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B

Antibody data

Submit

Validation data

Product number: HPA048979 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048979, RRID:AB_2680584
Product name: Anti-CYP21A2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKK WADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYP21A2 protein structure - HPA048979 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-CYP21A2 antibody. Corresponding CYP21A2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, kidney and testis using Anti-CYP21A2 antibody HPA048979 (A) shows similar protein distribution across tissues to independent antibody HPA053371 (B).
Antibody #2 product nr: HPA053371
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of adrenal gland shows strong cytoplasmic positivity in cortical cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CYP21A2 antibody HPA048979.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CYP21A2 antibody HPA048979.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CYP21A2 antibody HPA048979.
Sample type: HUMAN