HPA010565

SHROOM4 antibody from Sigma-Aldrich
KIAA1202
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010565, RRID:AB_1079961
Product name
Anti-SHROOM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010565
Antibody type
Polyclonal
Antigen
shroom family member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSCALNPEEVLEQPQPLSFGHLEGSRQGSQSVPAE
QESFALHSSDFLPPIRGHLGSQPEQAQPPCYYGIG
GLWRTSGQEATESAKQEFQHFSPPSGAPGIPTSYS
AYYNISVAKAELLNKLKDQPEMAEIG
Storage
-20C
Provider Type Product Number
- No reagents -