HPA013959

PFKFB1 antibody from Sigma-Aldrich
PFRX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013959, RRID:AB_1855237
Product name
Anti-PFKFB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013959
Antibody type
Polyclonal
Antigen
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEALQIRKQCALAALKDVHNYLSHEEGHVAVFDAT
NTTRERRSLILQFAKEHGYKVFFIESICNDPGIIA
ENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVN
YQPLDEELDSHLSYIKIFDVG
Storage
-20C
Provider Type Product Number
- No reagents -