HPA023073

R3HCC1 antibody from Sigma-Aldrich
DKFZp564N123
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023073, RRID:AB_1855987
Product name
Anti-R3HCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023073
Antibody type
Polyclonal
Antigen
R3H and coiled-coil domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQPLYVPRVLRKQEEWGLTSTSVLKREAPAGRDPE
EPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCE
NEPLLD
Storage
-20C
Provider Type Product Number
- No reagents -