HPA042873

FAM126A antibody from Atlas Antibodies
DRCTNNB1A, HCC, HYCC1, hyccin

Antibody data

Product number
HPA042873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042873, RRID:AB_2678207
Product name
Anti-FAM126A
Provider product page
Atlas Antibodies - HPA042873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVG
CGAGTDANRFSACSLQEEKLIYVSERTELPMKHQS
GQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.