Antibody data

Product number
PAB20520
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20520, RRID:AB_10963452
Product name
LOC203547 polyclonal antibody
Provider product page
Abnova Corporation - PAB20520
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LOC203547.
Antigen sequence
PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRT
PRSHRR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -