HPA010972

VMA21 antibody from Sigma-Aldrich
MEAX, XMEA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010972
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010972, RRID:AB_1853034
Product name
Anti-VMA21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010972
Antibody type
Polyclonal
Antigen
UPF0569 transmembrane protein LOC203547 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRT
PRSHRR
Storage
-20C
Provider Type Product Number
- No reagents -