HPA019867

PHRF1 antibody from Atlas Antibodies
KIAA1542, PPP1R125, RNF221

Antibody data

Product number
HPA019867
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019867, RRID:AB_1852416
Product name
Anti-PHRF1
Provider product page
Atlas Antibodies - HPA019867
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCIPSVLKPVEPSLGLLRADIGAASLSLFGDPYEL
DPFDSSEELSANPLSPLSAKRRALSRSALQSHQPV
ARPVSVGLSRRRLPAAVPEPDLEEEPVPDLLGSIL
SGQSLLMLGSSDVIIHRDGSLSAKRAAPVSFQR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.