HPA012887

ATP7A antibody from Sigma-Aldrich
MNK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012887, RRID:AB_1845205
Product name
Anti-ATP7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012887
Antibody type
Polyclonal
Antigen
Copper-transporting ATPase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWN
IEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISN
ALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEH
ERKGRTAVLVAVDDELC
Storage
-20C
Provider Type Product Number
- No reagents -