H00120534-B01P

ARL14EP antibody from Abnova Corporation
ARF7EP, C11orf46, FLJ38968
No application information provided.

Antibody data

Product number
H00120534-B01P
Provider
Abnova Corporation
Product name
C11orf46 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00120534-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C11orf46 protein.
Antigen sequence
MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELS
SNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFED
LQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKF
GRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPE
SDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRL
TKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCD
CLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQ
IEIEGGEIIHNKHAG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.