HPA039634

ARL14EP antibody from Atlas Antibodies
ARF7EP, C11orf46, FLJ38968

Antibody data

Product number
HPA039634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039634, RRID:AB_2676606
Product name
Anti-ARL14EP
Provider product page
Atlas Antibodies - HPA039634
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQK
RKPESDGRTAKALRSLQFTNPGRQTEFAPETGKRE
KRRLTKNATAGSDRQVIPAKSKVYDSQGLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.