HPA048127

ARL14EP antibody from Atlas Antibodies
ARF7EP, C11orf46, FLJ38968

Antibody data

Product number
HPA048127
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA048127, RRID:AB_2680277
Product name
Anti-ARL14EP
Provider product page
Atlas Antibodies - HPA048127
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRC
DRKWLYEQIEIEGGEIIHNKHA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.